reversed-phase HPLC raises a handful of sensible questions. This page answers them in order, starting with the fundamentals and moving to applications.
Reviewed 2026-01-02. Anything still debated is marked as such rather than presented as settled.
Selank is a synthetic heptapeptide with the sequence Thr-Lys-Pro-Arg-Pro-Gly-Pro. It was designed as a stabilized analogue of tuftsin, a naturally occurring tetrapeptide fragment derived from the immunoglobulin heavy chain. The additional Pro-Gly-Pro segment at the carboxyl terminus is intended to slow enzymatic cleavage. The compound is usually described in the literature as a synthetic peptide with anxiolytic and cognitive-related activity, a label that reflects a research context rather than an approved therapeutic category.
Most published work on selank originates from a small number of research groups in the Russian Federation. A large share of that record appears in Russian-language journals, which limits access for readers who rely on English-indexed databases. Independent replication by laboratories outside the original research network is sparse in publicly available sources. This concentration of origin and language is a frequently noted feature when the compound is summarized in broader reviews of synthetic peptides.
The compound was designed at the Institute of Molecular Genetics of the Russian Academy of Sciences during the 1980s and 1990s. The stated design goal was to retain the immunomodulatory and central nervous system activity attributed to tuftsin while improving resistance to enzymatic breakdown. Adding a proline-rich tail to the short parent peptide was a deliberate strategy, because proline residues restrict the conformations available to many peptidases. The same laboratory produced Semax, an ACTH fragment analog, and both compounds were developed in parallel as short, enzymatically stabilized peptides intended for intranasal use.
Selank is not a naturally occurring peptide and has no known endogenous counterpart in human physiology. Russian-language sources frequently call it TP-7, while English-language sources use the name Selank almost exclusively. Database indexing is uneven, partly because early reports appeared in regional journals that are not widely cataloged. Some summaries describe the material as a tuftsin analog and others as a synthetic heptapeptide; the labels overlap rather than conflict. Citing the primary sequence resolves ambiguity more reliably than the research or trade name alone.
Selank is a synthetic heptapeptide with the sequence Thr-Lys-Pro-Arg-Pro-Gly-Pro, written TKPRPGP in one-letter notation. Its structure consists of the immunomodulatory tetrapeptide tuftsin, Thr-Lys-Pro-Arg, extended at the carboxyl terminus by a Pro-Gly-Pro segment. The molecular formula is commonly given as C33H57N11O9, corresponding to a monoisotopic mass near 751.4 Da and an average molecular mass near 751.9 Da. All seven residues are proteinogenic amino acids, and the molecule carries no modified side chains or non-natural linkages.
| Property | Value | Notes |
|---|---|---|
| Molecular formula | C33H57N11O9 | Derived from the seven-residue sequence |
| Molecular weight | About 751.9 g/mol | Average mass; the monoisotopic value is slightly lower |
| Residue count | Seven amino acids | Thr-Lys-Pro-Arg-Pro-Gly-Pro |
| Parent compound | Tuftsin (Thr-Lys-Pro-Arg) | Selank extends tuftsin at the C-terminus |
| Compound class | Synthetic short peptide | Studied in a research setting; not a licensed drug in most markets |
Lyophilised material kept dry at minus 20 degrees Celsius or colder is the most stable form, and suppliers commonly state a shelf life of two years or more under those conditions. Once dissolved, degradation accelerates through hydrolysis and deamidation, particularly at alkaline pH or elevated temperature. Working solutions are usually divided into single-use aliquots to avoid repeated freeze-thaw cycles. The choice of reconstitution solvent affects both stability and the ionic strength of the final preparation.
Reverse-phase high-performance liquid chromatography with ultraviolet detection near 214 nanometres is the standard purity method. Mass spectrometry, typically electrospray ionisation, confirms identity through the expected mass-to-charge pattern. Amino acid analysis can verify composition independently. Chiral purity requires separate techniques such as derivatisation followed by chromatographic separation, and such data are rarely reported for research-grade material.
Quantification in biological matrices relies on liquid chromatography coupled to tandem mass spectrometry with stable-isotope internal standards. Low plasma concentrations and adsorption to container surfaces both complicate measurement. Solid-phase extraction is often needed to reduce matrix interference before injection. Reported limits of quantification differ widely between laboratories, which makes direct comparison of pharmacokinetic results difficult and limits meta-analysis.
Naming conventions place Selank in the same research family as Semax, another Russian-developed peptide investigated for cognitive effects. The two compounds share a lineage but differ in sequence and in the biological systems proposed as their targets. Semax descends from ACTH fragments, whereas Selank descends from tuftsin. Publications sometimes identify Selank by its full peptide sequence or by laboratory codes rather than one uniform trade name. Because replication outside Russia is limited, reports on its properties are best read alongside the study design and the purity of the material tested.
Selank is a synthetic heptapeptide developed in Russia during the 1990s. Researchers at the Institute of Molecular Genetics of the Russian Academy of Sciences designed it as a stabilized analog of tuftsin, a naturally occurring immunomodulatory tetrapeptide. The compound has been studied primarily for its reported anxiolytic and nootropic effects. It remains largely unknown in Western pharmacology and is not approved as a medicine by major regulators such as the FDA or the EMA.
Peptide bonds in selank are susceptible to hydrolysis under strongly acidic or basic conditions, and the terminal proline residues are vulnerable to exopeptidase activity in biological samples. Lyophilized powder stored dry at -20 °C typically remains stable for extended periods, whereas aqueous solutions degrade faster and may lose measurable purity within days to weeks depending on pH, temperature, and microbial load. Repeated freeze-thaw cycles promote aggregation and adsorption to container surfaces. For analytical work, solutions are usually prepared fresh, kept cold, and used within a single working day.
Handling follows standard practice for research peptides. Material is weighed in a low-humidity environment because the powder absorbs atmospheric moisture. Purity is reported as the percentage area of the main peak in a chromatogram, with specifications commonly set at 95 percent or higher; values below that threshold indicate the presence of truncated or modified species. Residual trifluoroacetate from purification is often present and may affect mass balance. Certificates of analysis should state the analytical method, the column and gradient used, and the lot-specific retention time so that results can be compared across suppliers.
Identity and purity of selank are established with reversed-phase high-performance liquid chromatography coupled to mass spectrometry. The peptide elutes from C18 columns with acetonitrile gradients in water containing trifluoroacetic acid or formic acid, and detection is usually performed by ultraviolet absorbance near 214 nm. Electrospray ionization in positive mode gives a doubly protonated ion near m/z 377, consistent with a mass of about 752 Da. Amino acid analysis or tandem mass spectrometry of fragment ions confirms the sequence. Because the molecule has no aromatic residues, it lacks a usable 280 nm chromophore, so low-wavelength detection or mass spectrometry is required.
Selank is a hydrophilic peptide and dissolves readily in water and in aqueous buffers. The lyophilised powder is typically a white to off-white solid. Because short peptides are prone to hydrolysis and oxidation, handling benefits from limiting exposure to heat, moisture and strong light. Working solutions are commonly prepared in sterile water or saline, and repeated freeze-thaw cycles are avoided to reduce aggregation and loss of activity. These practices reflect general laboratory convention rather than published stability specifications.
Dry powder is normally held at -20 degrees Celsius or lower, in a sealed container with desiccant and protection from light. Reconstituted solutions are usually kept at 2 to 8 degrees Celsius for short periods and frozen for longer ones. Proline residues at several positions are generally associated with some resistance to peptidase attack, but chemical stability still declines at neutral to alkaline pH and at elevated temperature. Exact shelf-life figures are product-specific and are not standardised across suppliers.
== Multimodal AI agents == In addition to large language models (LLMs), vision-language models (VLMs) and multimodal foundation models can be used as the basis for agents. Allen Institute for AI released an open-source vision-language model in 2024. Nvidia released a framework for developers to use VLMs, LLMs and retrieval-augmented generation for building AI agents that can analyze images and videos, including video search and video summarization. Microsoft released a multimodal agent model – trained on images, video, software user interface interactions, and robotics data – that the company claimed can manipulate software and robots.
=== Non-competitive === In non-competitive inhibition the binding of the inhibitor to the enzyme reduces its activity but does not affect the binding of substrate. This type of inhibitor binds with equal affinity to the free enzyme as to the enzyme-substrate complex. It can be thought of as having the ability of competitive and uncompetitive inhibitors, but with no preference to either type. As a result, the extent of inhibition depends only on the concentration of the inhibitor. Vmax will decrease due to the inability for the reaction to proceed as efficiently, but Km will remain the same as the actual binding of the substrate, by definition, will still function properly.
== Research == Muscimol has been clinically studied for a number of potential medical uses. It was assessed in small clinical studies in the treatment of Huntington's disease, tardive dyskinesia, and schizophrenia in the 1970s but was not found to be useful for these indications. Another study evaluated muscimol in schizophrenics with tardive dyskinesia in 1992. Studies also assessed the biochemical effects of muscimol in humans in the late 1970s and early 1980s. According to Povl Krogsgaard-Larsen, muscimol was too toxic and non-selective and as such was not developed for use as a pharmaceutical drug. Instead, the synthetic analogue gaboxadol (THIP), which was more selective and much less toxic, was developed. In 2019, a phase 1 clinical trial of muscimol for drug-resistant epilepsy was published. It has also been formally investigated for potential treatment of Alzheimer's disease and Parkinson's disease. A 2023 systematic review and meta-analysis of 22 preclinical studies found that muscimol reduces neuropathic pain in animals, with effects beginning within 15 minutes and lasting up to 3 hours. Muscimol has never been approved as a pharmaceutical drug for any use anywhere in the world.
=== 15 March === Ukroboronprom, with the help of a "NATO country", started manufacturing 125 mm smoothbore ammunition for Ukraine's Soviet-era tanks. Also being manufactured were 120 mm mortar rounds, 122 mm and 152 mm artillery shells. The production of projectiles is completely dispersed over a large number of cities. This is part of a larger effort by Ukraine to manufacture ammunition as Western donors have reached into their own stockpiles. Sébastien Lecornu, Minister of Armed Forces for France, announced that AMX-10 RC armored fighting vehicles have arrived in Ukraine.
Sources: en.wikipedia.org
=== Street Cricket === The Mid West Rhinos are embarking on another project to bring "Street Cricket" to the suburb of Mbizo. The project which was started by Sporting Chance aims to give young people an opportunity to play a simple version of cricket within their community. Street Cricket can be played with just a bat and ball and it is hoped that by operating this project, the young people will be able to learn new skills and will encourage them to take up the full version of the game. Sponsorship Whilst the funding of local cricket comes from Zimbabwe Cricket, there is still a requirement for sponsorship from external sources. The majority of funding for League cricket comes from the Cold Chain Group. The other sponsors include Lays, Bokomo, Castle and local sponsors such as Steel Makers, Cricket Tours Africa and Vinyl Stikka Signs.
The Yucatec, who came from Yucatán, Mexico, to escape the violent Caste War of the 1840s. The Mopan, who are indigenous to Belize but were forced out to Guatemala by the British for raiding settlements. They returned to Belize to evade enslavement by the Guatemalans in the 19th century. The Q'eqchi', who also fled from slavery in Guatemala in the 19th century. The latter groups are chiefly found in the Toledo District. The Maya speak their native languages and Spanish, and are also often fluent in English and Belizean Creole.
In the wild, adult Komodo dragons usually weigh around 70 kg (150 lb), although captive specimens often weigh more. According to Guinness World Records, an average adult male will weigh 79 to 91 kg (174 to 201 lb) and measure 2.59 m (8.5 ft), while an average female will weigh 68 to 73 kg (150 to 161 lb) and measure 2.29 m (7.5 ft). The largest verified specimen in captivity was 3.1–3.13 m (10 ft 2 in – 10 ft 3 in) long and weighed 166 kg (366 lb), including its undigested food. The largest wild specimen had a length 3.04 m (10 ft), a snout-vent length (SVL) 1.54 m (5 ft 1 in) and a mass of 81.5 kg (180 lb) excluding stomach contents. The heaviest reached a mass of 87.4 kg (193 lb). The study noted that weights greater than 100 kg (220 lb) were possible but only after the animal had consumed a large meal. The Komodo dragon has a tail as long as its body, as well as about 60 frequently replaced, serrated teeth that can measure up to 2.5 cm (1 in) in length. Its saliva is frequently blood-tinged because its teeth are almost completely covered by gingival tissue that is naturally lacerated during feeding. It also has a long, yellow, deeply forked tongue.
Even from the early pioneering work in sea urchin egg, it was clear from the pharmacological profile that NAADP acted upon a different channel from the IP3 receptor and ryanodine receptor and this has recently been borne out by the molecular identification of the NAADP receptor as members of the TPC (two-pore channel) family. As structural intermediates between single domain TRP and four-domain voltage-dependent calcium channel, the TPCs form oligomers (possibly dimers) to form the functional Ca2+ channel. Appropriately, these channels reside on acidic organelles (including different classes of endosomes and lysosomes) likely due to the presence of endolysomal targeting sequences. The effect of genetic manipulation of TPC levels (i.e. over-expression, knock-down or knock-out) is consistent with TPCs being the NAADP-gated channel. Moreover, TPCs recapitulate many of the characteristics of NAADP-induced Ca2+ release i.e. they promote Ca2+ release from acidic stores, correlate with NAADP-binding sites, exhibit a bell-shaped NAADP concentration-response curve, sensitivity to the NAADP antagonist, Ned-19, and provide trigger Ca2+ that is subsequently amplified by ER Ca2+ channels.
ALFA-tag, a de novo designed helical peptide tag (SRLEEELRRRLTE) for biochemical and microscopy applications. The tag is recognized by a repertoire of single-domain antibodies AviTag, a peptide allowing biotinylation by the enzyme BirA and so the protein can be isolated by streptavidin (GLNDIFEAQKIEWHE) EPEA-tag, commercially called CaptureSelect C-tag, a 4 AA peptide that is recognized by a VHH or single-domain camelid antibody which was discovered through phage display (EPEA) Calmodulin-tag, a peptide bound by the protein calmodulin (KRRWKKNFIAVSAANRFKKISSSGAL) iCapTag™ (intein Capture Tag), a self-removing peptide-based tag (MIKIATRKYLGKQNVYGIGVERDHNFALKNGFIAHN). The iCapTag™ is controlled by pH change. Typically the pH change occurs from pH 8.5 to pH 6.2 and causes release of tagless target-protein to eluent. If needed the pH shift and buffers can be optimized for protein-specific purification method (e.g., for membrane proteins detergent could be added to the buffers to increase solubility of the protein). In contrast to other protein purification methods, this method is not relaying on proteases to cleave off a tag from tag-protein complex. Instead, during elution phase since buffer pH is changed from 8.5 to pH 6.2 that triggers cleavage reaction resulting in a release of tagless target protein while highly engineered tag stays attached to the column. The expected purity of tagless target proteins or peptides is between 95-99%. The iCapTag™ contains patented component derived from Nostoc punctiforme (Npu) intein.
Sources: en.wikipedia.org
==== Attachment and biofilm formation ==== Attachment is another important method for regulating algicidal activity, as it can elongate the duration of interactions between bacteria and algae. It was observed that the number of attached bacteria per diatom was positively correlated with the lysis rate of algal cells, and the lysis rate increased when attachment rates were elevated. Attachment can be strengthened through biofilm formation, which consists of extracellular polymeric substances (EPS), adhesins, and other components capable of aggregating cells together. Biofilms allow for elongated interactions between bacteria and algal cells, and maintain the exchange of nutrients and gases.
The NHS Grampian health board announcing it is to divert ambulance patients to hospitals outside its area because of "critical" pressure on its largest hospital. 29 November – Finlay MacDonald, who carried out a series of shootings on the Isle of Skye and the Scottish mainland, which included the fatal shooting of his brother-in-law, is sentenced to life imprisonment with a minimum term of 28 years. GP leaders in Scotland vote in favour of a motion to ballot workers on industrial action over pay, following what they describe as "years of disinvestment in general practice". 30 November – The Proclaimers perform at a memorial service for former first minister Alex Salmond, held at Edinburgh's St Giles' Cathedral.
Glycopyrronium bromide is a medication of the muscarinic anticholinergic group. It does not cross the blood–brain barrier and consequently has few to no central effects. It can be administered orally, intravenously, topically, or via inhalation. It is a synthetic quaternary ammonium compound. The cation, which is the active moiety, is called glycopyrronium (INN) or glycopyrrolate (USAN). The most common side effects include irritability, flushing, nasal congestion, reduced secretions in the airways, dry mouth, constipation, diarrhea, nausea and vomiting, and urinary retention. In September 2012, glycopyrronium was approved for medical use in the European Union. In June 2018, glycopyrronium was approved by the U.S. Food and Drug Administration (FDA) to treat excessive underarm sweating, becoming the first drug developed specifically to reduce excessive sweating. It is on the World Health Organization's List of Essential Medicines.
=== Career === Since 2003, Paulsen has been based in Switzerland, where Ferring subsequently established its global headquarters in Saint-Prex. His business interests focus mainly on the Ferring Pharmaceuticals Group where he has worked since 1976 in senior executive positions. In addition, he has interests in real estate and viticulture. Frederik Paulsen also holds several board memberships. Until 2023, he was for instance a member of the board of directors of the tobacco company Philip Morris International. Since 2009 until 2022, Paulsen also held the position of Honorary Consul of the Russian Federation, in Lausanne, Switzerland. He was appointed Honorary Consul General in 2015. In 2020, he was appointed a Knight of the Order of St. John by Queen Elizabeth II.
karyogram A karyotype which depicts the entire set of chromosomes in a cell or organism by using photomicrographs of the actual chromosomes as they appear in vivo (usually during metaphase, in their most condensed forms), as opposed to the idealized illustrations of chromosomes used in idiograms. The photomicrographs are often still arranged in pairs and by size for easier identification of particular chromosomes, whereas in the actual nucleus there is seldom any apparent organization.
Sources: en.wikipedia.org
Selank is a synthetic heptapeptide with the sequence Thr-Lys-Pro-Arg-Pro-Gly-Pro, designed as a metabolically stabilized analogue of the endogenous tetrapeptide tuftsin. It has been studied mainly against anxiety-related and cognitive endpoints rather than as an approved medicine in most jurisdictions.
Tuftsin contains four residues, while selank carries an additional Pro-Gly-Pro segment at the carboxyl end. That extension is intended to reduce enzymatic cleavage. Comparative pharmacokinetic data in humans remain limited.
No single receptor target is widely accepted as the definitive mediator of the reported effects. Proposed contributors include GABAergic modulation, shifts in monoamine turnover, and altered neuropeptide degradation. The mechanism is treated in the literature as unresolved.
The sequence is Thr-Lys-Pro-Arg-Pro-Gly-Pro, written TKPRPGP in one-letter code. It combines the tetrapeptide tuftsin with a carboxyl-terminal Pro-Gly-Pro extension. This full sequence identifies the molecule more precisely than the research name.